Analytical Data
-
Gene name
SCG2
- Application
-
Alternative Names
SCG2;CHGC;;Secretogranin-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P13521
-
Expression Region
418-617aa
-
AA Sequence
TPGRAGTEALPDGLSVEDILNLLGMESAANQKTSYFPNPYNQEKVLPRLPYGAGRSRSNQLPKAAWIPHVENRQMAYENLNDKDQELGEYLARMLVKYPEIINSNQVKRVPGQGSSEDDLQEEEQIEQAIKEHLNQGSSQETDKLAPVSKRFPVGPPKNDDTPNRQYWDEDLLMKVLEYLNQEKAEKGREHIAKRAMENM
-
Molecular Weight
54.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SCG2, or secretogranin II, is a protein belonging to the secretogranin family, which plays a crucial role in the synthesis, storage, and release of certain neuropeptides and hormones. Its expression is primarily found in the neuroendocrine system, where it is involved in the regulation of neurosecretion and synaptic transmission. Research on SCG2 has gained momentum due to its potential implications in neurodegenerative diseases, such as Alzheimer's and Parkinson's, where altered neuropeptide signaling is observed. Additionally, SCG2 is believed to participate in the formation of dense-core vesicles, which are vital for neurotransmitter packaging and release. Understanding the molecular mechanisms governing SCG2’s function and its interactions with other proteins and signaling pathways can provide valuable insights into its role in normal physiology and disease states. Recent studies have also highlighted its potential as a biomarker for certain cancers, making it a target of interest in both basic biomedical research and therapeutic development. Moreover, the recombinant production of SCG2 can facilitate the investigation of its structure-function relationships and the development of SCG2-based assays or treatments, further underscoring the need for detailed studies in this area. As the understanding of SCG2’s multifaceted roles expands, it may pave the way for novel therapeutic strategies targeting neuroendocrine disorders and related pathologies.











