Cat: PA1000-4173

Recombinant Human SCG2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SCG2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SCG2;CHGC;;Secretogranin-2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P13521

  • Expression Region

    418-617aa

  • AA Sequence

    TPGRAGTEALPDGLSVEDILNLLGMESAANQKTSYFPNPYNQEKVLPRLPYGAGRSRSNQLPKAAWIPHVENRQMAYENLNDKDQELGEYLARMLVKYPEIINSNQVKRVPGQGSSEDDLQEEEQIEQAIKEHLNQGSSQETDKLAPVSKRFPVGPPKNDDTPNRQYWDEDLLMKVLEYLNQEKAEKGREHIAKRAMENM

  • Molecular Weight

    54.3 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SCG2, or secretogranin II, is a protein belonging to the secretogranin family, which plays a crucial role in the synthesis, storage, and release of certain neuropeptides and hormones. Its expression is primarily found in the neuroendocrine system, where it is involved in the regulation of neurosecretion and synaptic transmission. Research on SCG2 has gained momentum due to its potential implications in neurodegenerative diseases, such as Alzheimer's and Parkinson's, where altered neuropeptide signaling is observed. Additionally, SCG2 is believed to participate in the formation of dense-core vesicles, which are vital for neurotransmitter packaging and release. Understanding the molecular mechanisms governing SCG2’s function and its interactions with other proteins and signaling pathways can provide valuable insights into its role in normal physiology and disease states. Recent studies have also highlighted its potential as a biomarker for certain cancers, making it a target of interest in both basic biomedical research and therapeutic development. Moreover, the recombinant production of SCG2 can facilitate the investigation of its structure-function relationships and the development of SCG2-based assays or treatments, further underscoring the need for detailed studies in this area. As the understanding of SCG2’s multifaceted roles expands, it may pave the way for novel therapeutic strategies targeting neuroendocrine disorders and related pathologies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US