Analytical Data
-
Gene name
C11orf60
- Application
-
Alternative Names
IFT46. C11orf2. C11orf60
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NQC8
-
Expression Region
1-304aa
-
AA Sequence
MADNSSDECEEENNKEKKKTSQLTPQRGFSENEDDDDDDDDSSETDSDSDDDDEEHGAPLEGAYDPADYEHLPVSAEIKELFQYISRYTPQLIDLDHKLKPFIPDFIPAVGDIDAFLKVPRPDGKPDNLGLLVLDEPSTKQSDPTVLSLWLTENSKQHNITQHMKVKSLEDAEKNPKAIDTWIESISELHRSKPPATVHYTRPMPDIDTLMQEWSPEFEELLGKVSLPTAEIDCSLAEYIDMICAILDIPVYKSRIQSLHLLFSLYSEFKNSQHFKALAEGKKAFTPSSNSTSQAGDMETLTFS
-
Molecular Weight
60.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C11orf60, also known as C11orf60 protein, is a relatively uncharacterized human protein encoded by the chromosome 11 open reading frame 60 gene. Recent studies have highlighted its potential roles in various biological processes, including cellular signaling, immune response, and development. The interest in C11orf60 has surged due to its implications in several diseases, particularly its association with cancer progression and autoimmune disorders. Research has shown that the expression levels of C11orf60 can significantly impact cell proliferation and apoptosis, suggesting that it may function as a regulatory molecule within critical pathways. Furthermore, preliminary data indicate that C11orf60 might interact with other proteins involved in tumorigenesis, thus laying the groundwork for deeper investigations into its mechanisms of action. Understanding the structure and function of C11orf60 through recombinant protein studies can provide valuable insights into its physiological roles and therapeutic potential. As biotechnology advances, the generation of recombinant C11orf60 proteins will facilitate the exploration of its interactions and functions, paving the way for novel diagnostic and therapeutic strategies targeting diseases associated with its dysregulation. Overall, the study of C11orf60 represents a promising area of research within molecular biology and medicine, aiming to elucidate the complex roles of this enigmatic protein in health and disease.
