Analytical Data
-
Gene name
C11orf15
- Application
-
Alternative Names
TMEM9B; C11orf15; UNQ712/PRO1375; Transmembrane Protein 9B
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NQ34
-
Expression Region
34-198aa
-
AA Sequence
AKNFEDVRCKCICPPYKENSGHIYNKNISQKDCDCLHVVEPMPVRGPDVEAYCLRCECKYEERSSVTIKVTIIIYLSILGLLLLYMVYLTLVEPILKRRLFGHAQLIQSDDDIGDHQPFANAHDVLARSRSRANVLNKVEYAQQRWKLQVQEQRKSVFDRHVVLS
-
Molecular Weight
43.89 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C11orf15, also known as FAM118B, is a human gene located on chromosome 11 that has garnered attention due to its potential roles in various biological processes and diseases. Recent studies suggest that C11orf15 may be implicated in neurodegenerative disorders, metabolic syndromes, and autoimmune conditions, making it a candidate for further research in therapeutic applications. The protein encoded by C11orf15 is thought to be involved in regulating cellular functions, including cell signaling pathways and apoptosis. Given its involvement in critical biological mechanisms, the production of recombinant C11orf15 protein has become a focal point for researchers aiming to study its structure-function relationships and interactions with other cellular components. The development of reliable recombinant expression systems can accelerate the understanding of this protein's role in health and disease. This background sets the stage for investigating C11orf15 in various experimental contexts, providing insights into its potential as a biomarker or therapeutic target.
