Cat: PA2000-1827

Recombinant Human SLFN12L Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SLFN12L

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SLFN12L;SLFN5;Schlafen family member 12-like

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q6IEE8

  • Expression Region

    1-588aa

  • AA Sequence

    MDLARKEFLRGNGLAAGKMNISIDLDTNYAELVLNVGRVTLGENNRKKMK DCQLRKQQNENVSRAVCALLNSGGGVIKAEVENKGYSYKKDGIGLDLENS FSNMLPFVPNFLDFMQNGNYFHIFVKSWSLETSGPQIATLSSSLYKRDVT SAKVMNASAALEFLKDMEKTGGRAYLRPEFPAKRACVDVQEESNMEALAA DFFNRTELGYKEKLTFTESTHVEIKNFSTEKLLQRITEILPQYVSAFANT DGGYLFVGLNEDKEVIGFKAEKSYLTKLEEVTKNSIGKLPVHHFCVEKGT INYLCKFLGVYDKGRLCGYVYALRVERFCCAVFAKKPDSWHVKDNRVKQL TEKEWIQFMVDSEPVCEELPSPASTSSPVSQSYPLREYINFKIQPLRYHL PGLSEKITCAPKTFCRNLFSQHEGLKQLICEEMGSVNKGSLIFSRSWSLD LGLQENHKVLCDALLISQDKPPVLYTFHMVQDEEFKDYSTQTAQTLKQKL AKIGGYTKKVCVMTKIFYLSPEGKTSCQYDLNSQVIYPESYYWTTAQTMK DLEKALSNILPKENQIFLFVCLFRFCLFVCWFVCFFLR

  • Molecular Weight

    72 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SLFN12L ( schlafen 12-like) is a member of the schlafen family of proteins, which are involved in various cellular processes, including immune response and cellular differentiation. The gene encoding SLFN12L has been identified as playing a crucial role in the regulation of stress responses and may influence the cellular proliferation in various conditions, including cancer. Recent studies suggest that SLFN12L may have a role in antiviral responses, particularly in the context of viral infections, where it appears to mediate the innate immune response. Given its potential implications in health and disease, the recombinant expression of SLFN12L protein has garnered significant attention for its role in understanding immune mechanisms and developing therapeutic strategies. Research focusing on the characterization and functional analysis of SLFN12L recombinant protein can provide insights into its biological functions and interactions with other cellular components. Additionally, elucidating the mechanisms by which SLFN12L modulates immune signaling pathways can enhance our understanding of its potential as a target for therapeutic intervention in immune-related disorders and viral infections. This research not only contributes to the fundamental knowledge of the schlafen family but also holds promise for future applications in biotechnology and medicine. By investigating the properties of SLFN12L, scientists aim to unlock its therapeutic potential and assess its roles in various biological contexts. As such, SLFN12L represents an important molecule in the field of immunology and a promising candidate for further research and development.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US