Analytical Data
-
Gene name
C11orf10
- Application
-
Alternative Names
MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLLLWVGIYV
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P61165
-
Expression Region
1-79aa
-
AA Sequence
MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLLLWVGIYV
-
Molecular Weight
35.09 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C11orf10, also known as "chromosome 11 open reading frame 10," is a gene located on chromosome 11 that has garnered attention in molecular biology and genetics due to its potential roles in various biological processes and diseases. Emerging evidence suggests that C11orf10 is implicated in immune responses, inflammation, and possibly neurodegenerative diseases. Its expression patterns and functional relevance in different tissues have prompted researchers to explore the protein's biological activities through recombinant protein studies. The use of C11orf10 recombinant protein allows scientists to investigate its structure-function relationships, interactions with other biomolecules, and impacts on cellular pathways. Moreover, elucidating the role of C11orf10 in pathological conditions could open new avenues for therapeutic interventions. Understanding the mechanisms by which C11orf10 operates within cellular contexts is essential for advancing knowledge in areas such as autoimmune diseases, cancer, and neurobiology. Overall, studies involving C11orf10 recombinant protein are critical for deciphering its biological significance and exploring its potential as a biomarker or therapeutic target in various health conditions.
