Cat: PA1000-4070

Recombinant Human IFNAR2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IFNAR2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IFNAR2;IFNABR;Interferon alpha/beta receptor 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P48551

  • Expression Region

    27-243aa

  • AA Sequence

    ISYDSPDYTDESCTFKISLRNFRSILSWELKNHSIVPTHYTLLYTIMSKP EDLKVVKNCANTTRSFCDLTDEWRSTHEAYVTVLEGFSGNTTLFSCSHNF WLAIDMSFEPPEFEIVGFTNHINVMVKFPSIVEEELQFDLSLVIEEQSEG IVKKHKPEIKGNMSGNFTYIIDKLIPNTNYCVSVYLEHSDEQAVIKSPLK CTLLPPGQESESAESAKVDHHHHHH

  • Molecular Weight

    26 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interferon-alpha receptor 2 (IFNAR2) is a crucial protein that plays a significant role in the immune response mediated by type I interferons, which are vital for combating viral infections and modulating the immune system. It is one of the two subunits of the type I interferon receptor, with the other being IFNAR1. The binding of type I interferon to this receptor initiates a cascade of signaling events that lead to the expression of various antiviral proteins and immune-modulatory factors, thereby enhancing the host's defense mechanisms. Research into IFNAR2 has gained prominence due to its implications in viral pathogenesis, autoimmune diseases, and potential therapeutic applications. Understanding the structural and functional dynamics of IFNAR2 can provide insights into its role in these processes. Moreover, recombinant IFNAR2 proteins are valuable tools for investigating receptor interactions, signaling pathways, and the development of antiviral drugs. Studying the mechanisms by which IFNAR2 mediates its effects can lead to advancements in vaccine development and targeted therapies for diseases related to dysregulated interferon responses. Additionally, the exploration of IFNAR2 interactions with other cellular proteins may uncover novel therapeutic targets for enhancing antiviral immune responses or mitigating autoimmune disorders. Overall, the study of IFNAR2 and its recombinant forms represents a promising avenue for research in immunology and virology, with the potential to inform future clinical strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US