Analytical Data
-
Gene name
POU4F1
- Application
-
Alternative Names
POU domain. class 4. transcription factor 1. Brain-specific homeobox/POU domain protein 3A. Brain-3A. Brn-3A. Homeobox/POU domain protein RDC-1. Oct-T1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q01851
-
Expression Region
1-419 aa
-
AA Sequence
MMSMNSKQPHFAMHPTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASLDETLLARAEALAAVDIAVSQGKSHPFKPDATYHTMNSVPCTSTSTVPLAHHHHHHHHHQALEPGDLLDHISSPSLALMAGAGGAGAAAGGGGAHDGPGGGGGPGGGGGPGGGPGGGGGGGPGGGGGGPGGGLLGGSAHPHPHMHSLGHLSHPAAAAAMNMPSGLPHPGLVAAAAHHGAAAAAAAAAAGQVAAASAAAAVVGAAGLASICDSDTDPRELEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEGAQREKMNKPELFNGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY
-
Molecular Weight
73.04 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
POU4F1, also known as Brn-3a, is a member of the POU domain family of transcription factors, which play crucial roles in neural development and differentiation. This protein is primarily expressed in the nervous system, particularly in sensory neurons and the retina, where it is involved in the regulation of target gene expression essential for neuronal survival and function. Recent studies have highlighted the pivotal role of POU4F1 in promoting the survival of retinal ganglion cells and its implications in neurodegenerative diseases such as glaucoma. Given its significant involvement in neuronal development and disease processes, researchers have increasingly focused on the production and characterization of recombinant POU4F1 protein. This enables the investigation of its functional properties, interaction with other proteins, and the molecular pathways it regulates. Furthermore, recombinant POU4F1 could serve as a valuable tool for drug discovery and gene therapy approaches aimed at neuroprotection and regeneration, making it a promising candidate for therapeutic interventions in neural disorders. By understanding its structure and function through recombinant technology, researchers aim to elucidate the mechanisms by which POU4F1 contributes to neuronal health and the potential for restoring function in damaged nervous tissue.
