Analytical Data
-
Gene name
POLS
- Application
-
Alternative Names
DNA polymerase kappa; DNA polymerase sigma; LAK 1; LAK-1; LAK1; OTTHUMP00000115520; PAP associated domain containing 7; PAP-associated domain-containing protein 7; Papd7; PAPD7_HUMAN; POLK; POLS; Polymerase (DNA directed) sigma; Polymerase DNA Directed Sigma; Terminal uridylyltransferase 5; Topoisomerase related function protein 4 1; Topoisomerase-related function protein 4-1; TRF4 1; TRF4; TRF4-1; TRF41; TUTase 5; TUTASE5
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5XG87
-
Expression Region
1-542 aa
-
AA Sequence
MSPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGSFSTGLYLPTSDIDLVVFGKWERPPLQLLEQALRKHNVAEPCSIKVLDKATVPIIKLTDQETEVKVDISFNMETGVRAAEFIKNYMKKYSLLPYLILVLKQFLLQRDLNEVFTGGISSYSLILMAISFLQLHPRIDARRADENLGMLLVEFFELYGRNFNYLKTGIRIKEGGAYIAKEEIMKAMTSGYRPSMLCIEDPLLPGNDVGRSSYGAMQVKQVFDYAYIVLSHAVSPLARSYPNRDAESTLGRIIKVTQEVIDYRRWIKEKWGSKAHPSPGMDSRIKIKERIATCNGEQTQNREPESPYGQRLTLSLSSPQLLSSGSSASSVSSLSGSDVDSDTPPCTTPSVYQFSLQAPAPLMAGLPTALPMPSGKPQPTTSRTLIMTTNNQTRFTIPPPTLGVAPVPCRQAGVEGTASLKAVHHMSSPAIPSASPNPLSSPHLYHKQHNGMKLSMKGSHGHTQGGGYSSVGSGGVRPPVGNRGHHQYNRTGWRRKKHTHTRDSLPVSLSR
-
Molecular Weight
86.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
POLS, or Polymerase θ, is a member of the DNA polymerase family known for its unique role in DNA repair and replication, particularly in the context of double-strand break (DSB) repair. Its distinctiveness lies in its ability to utilize a template-dependent and template-independent mechanism, allowing it to synthesize DNA across damaged regions. This has garnered significant interest within the scientific community due to its implications in genome stability, cancer biology, and potential therapeutic applications. Dysregulation or overexpression of POLS has been associated with various cancers, suggesting that it may play a crucial role in tumorigenesis and therapeutic resistance. Additionally, the study of POLS is crucial for understanding mechanisms such as homologous recombination and non-homologous end joining, both vital for maintaining genetic integrity. Recent advancements in structural biology have provided insights into the enzyme's activity, revealing critical interactions and conformational changes during DNA synthesis. These findings pave the way for potential drug design aimed at targeting POLS in cancer therapy, as inhibiting its function could sensitize tumor cells to DNA-damaging agents. Thus, the ongoing research on POLS is not only pivotal for unraveling fundamental biological processes but also for developing innovative strategies to combat cancer and enhance the efficacy of existing treatments.
