Analytical Data
-
Gene name
POLRMT
- Application
-
Alternative Names
APOLMT; DNA-directed RNA polymerase; DNA-directed RNA polymerase mitochondrial; h-mtRPOL; mitochondrial; MTRNAP; MtRPOL; POLRMT; polymerase (RNA) mitochondrial (DNA directed); polymerase. RNA. mitochondrial; RPOM; RPOM_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00411
-
Expression Region
1121-1230 aa
-
AA Sequence
PNFIHSLDSSHMMLTALHCYRKGLTFVSVHDCYWTHAADVSVMNQVCREQFVRLHSEPILQDLSRFLVKRFCSEPQKILEASQLKETLQAVPKPGAFDLEQVKRSTYFFS
-
Molecular Weight
37.84 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
POLRMT, or mitochondrial RNA polymerase, is a crucial enzyme responsible for the transcription of mitochondrial DNA (mtDNA), which encodes essential proteins for mitochondrial function and energy production. The study of POLRMT has gained significant attention due to its pivotal role in cellular metabolism and its implications in various human diseases, including mitochondrial disorders and certain cancers. Research has shown that mutations in POLRMT can lead to impaired mitochondrial function, resulting in a range of metabolic deficiencies and contributing to the progression of age-related diseases. Additionally, understanding POLRMT's structure and function can provide insights into the regulation of mtDNA transcription and its interaction with other mitochondrial proteins. Recent advancements in recombinant protein technology have facilitated the production of POLRMT in vitro, allowing for detailed biochemical analyses and the exploration of its mechanisms of action. This research not only aims to elucidate the fundamental biological processes governing mitochondrial gene expression but also seeks to identify potential therapeutic targets for treating mitochondrial dysfunction-related diseases. As such, POLRMT stands at the intersection of basic research and clinical applications, driving a deeper understanding of mitochondrial biology and its broader implications for human health.
