Cat: PAX2000-10450

Recombinant Human POLRMT Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    POLRMT

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    APOLMT; DNA-directed RNA polymerase; DNA-directed RNA polymerase mitochondrial; h-mtRPOL; mitochondrial; MTRNAP; MtRPOL; POLRMT; polymerase (RNA) mitochondrial (DNA directed); polymerase. RNA. mitochondrial; RPOM; RPOM_HUMAN

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O00411

  • Expression Region

    1121-1230  aa

  • AA Sequence

    PNFIHSLDSSHMMLTALHCYRKGLTFVSVHDCYWTHAADVSVMNQVCREQFVRLHSEPILQDLSRFLVKRFCSEPQKILEASQLKETLQAVPKPGAFDLEQVKRSTYFFS

  • Molecular Weight

    37.84 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

POLRMT, or mitochondrial RNA polymerase, is a crucial enzyme responsible for the transcription of mitochondrial DNA (mtDNA), which encodes essential proteins for mitochondrial function and energy production. The study of POLRMT has gained significant attention due to its pivotal role in cellular metabolism and its implications in various human diseases, including mitochondrial disorders and certain cancers. Research has shown that mutations in POLRMT can lead to impaired mitochondrial function, resulting in a range of metabolic deficiencies and contributing to the progression of age-related diseases. Additionally, understanding POLRMT's structure and function can provide insights into the regulation of mtDNA transcription and its interaction with other mitochondrial proteins. Recent advancements in recombinant protein technology have facilitated the production of POLRMT in vitro, allowing for detailed biochemical analyses and the exploration of its mechanisms of action. This research not only aims to elucidate the fundamental biological processes governing mitochondrial gene expression but also seeks to identify potential therapeutic targets for treating mitochondrial dysfunction-related diseases. As such, POLRMT stands at the intersection of basic research and clinical applications, driving a deeper understanding of mitochondrial biology and its broader implications for human health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US