Analytical Data
-
Gene name
BTBD8
- Application
-
Alternative Names
BTBD8BTB/POZ domain-containing Protein 8
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5XKL5
-
Expression Region
1-378aa
-
AA Sequence
MARCGEGSAAPMVLLGSAGVCSKGLQRKGPCERRRLKATVSEQLSQDLLRLLREEFHTDVTFSVGCTLFKAHKAVLLARVPDFYFHTIGQTSNSLTNQEPIAVENVEALEFRTFLQIIYSSNRNIKNYEEEILRKKIMEIGISQKQLDISFPKCENSSDCSLQKHEIPEDISDRDDDFISNDNYDLEPASELGEDLLKLYVKPGCPDIDIFVDGKRFKAHRAILSARSSYFAAMLSGCWAESSQEYVTLQGISHVELNVMMHFIYGGTLDIPDKTNVGQILNMADMYGLEGLKEVAIYILRRDYCNFFQKPVPRTLTSILECLIIAHSVGVESLFADCMKWIVKHFARFWSERSFANIPPEIQKSCLNMLIQSLVNIT
-
Molecular Weight
69.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BTBD8, a member of the BTB/TAZ family of proteins, has garnered significant attention in recent years due to its potential roles in various cellular processes, including cell differentiation, proliferation, and the immune response. Research indicates that BTBD8 is involved in regulating transcriptional activity through its interactions with different protein partners, highlighting its importance in maintaining cellular homeostasis. Additionally, studies have suggested that BTBD8 may play a crucial role in disease contexts, particularly in cancer and autoimmune disorders, by modulating inflammatory pathways and gene expression profiles. The recombinant production of BTBD8 protein allows researchers to further investigate its structural and functional properties, facilitating the elucidation of its mechanisms of action. As the demand for understanding post-translational modifications and protein interactions grows, the study of recombinant BTBD8 promises to provide valuable insights into its biological functions and therapeutic potential, making it a focus for ongoing research in molecular biology and biomedicine.
