Analytical Data
-
Gene name
CD244
- Application
-
Alternative Names
CD244；2B4；Natural killer cell receptor 2B4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BZW8
-
Expression Region
22-221aa
-
AA Sequence
CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWEN GSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATF QVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLI QTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFR
-
Molecular Weight
49 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD244, also known as 2B4, is a member of the CD2 family of receptors and plays a crucial role in immune regulation, particularly in natural killer (NK) cell functionality. It is expressed on both NK cells and certain subsets of T cells, where it interacts with its ligand CD48, influencing cell activation, proliferation, and cytokine production. The study of CD244 recombinant protein has gained significance in immunological research due to its potential implications in cancer therapy, autoimmune diseases, and transplantation. Understanding the structure and function of CD244 can provide insights into its role in immune responses and its potential as a therapeutic target.
Researchers have focused on developing recombinant forms of CD244 to facilitate the investigation of its binding characteristics, cellular interactions, and downstream signaling pathways. This enables a better understanding of how CD244 regulates immune responses and can lead to the identification of novel strategies for modulating immune functions in clinical settings. The production of CD244 recombinant proteins using various expression systems allows for extensive characterization, paving the way for potential applications in immunotherapy and disease management. Overall, elucidating the role of CD244 in immune modulation presents promising avenues for enhancing therapeutic interventions and improving patient outcomes across a range of immunological disorders.
