Analytical Data
-
Gene name
Tnc
- Application
-
Alternative Names
Tnc；CAGL79；KIAA1856；Trinucleotide repeat-containing gene 18 Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P24821
-
Expression Region
1888-2201aa
-
AA Sequence
DSPRDLTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA
-
Molecular Weight
39.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Tnc, or Tenascin-C, is an extracellular matrix protein that plays a critical role in various biological processes, including tissue development, repair, and immune responses. Its expression is highly regulated during embryogenesis and is typically downregulated in healthy adult tissues, reappearing in pathological conditions such as cancer and inflammation. Research has indicated that Tnc interacts with a variety of cell types and affects signaling pathways that govern cell adhesion, migration, and proliferation. Notably, its overexpression in tumors is associated with increased metastasis and poor prognosis, making Tnc a potential biomarker for cancer progression. Additionally, Tnc has been implicated in various diseases beyond cancer, such as cardiovascular disorders, autoimmune diseases, and wound healing. Studies on Tnc have involved the exploration of its structural properties, molecular interactions, and potential as a therapeutic target. The recombinant production of Tnc proteins has enabled researchers to investigate its functional roles in vitro and in vivo more effectively, paving the way for novel therapeutic strategies that could manipulate Tnc's activities. This growing body of research aims to elucidate the complex roles of Tnc in health and disease, ultimately contributing to the development of targeted interventions that leverage its unique properties.
