Analytical Data
-
Gene name
SEMA4G
- Application
-
Alternative Names
SEMA4G；KIAA1619；Semaphorin-4G
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NTN9
-
Expression Region
1-127aa
-
AA Sequence
MGSMSPPSAWPCVLDGPETRQDLCQPPKPCVHSHAHMEECLSAGLQCPHP HLLLVHSCFIPASGLGVPSQLPHPIWSSSPASCGDLFVKSLGTGQPGEVR LHHSPPLPSCVALVNQPPHSPWSFSRV
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SEMA4G, a member of the semaphorin family, plays a critical role in various biological processes including neural development, immune response, and cancer progression. Research into SEMA4G has garnered attention due to its involvement in signaling pathways that affect cell communication and migration, particularly in the context of the nervous system. Studies have shown that SEMA4G interacts with various receptors and ligands, influencing cellular behaviors such as growth cone guidance during neuronal development. Additionally, its expression patterns have been linked to aberrant immune responses and the progression of certain cancers, making it a potential target for therapeutic interventions. The understanding of SEMA4G's structure and function has been enhanced by advances in recombinant protein technology, facilitating the study of its biological mechanisms and interactions at a molecular level. Investigating SEMA4G not only sheds light on fundamental cellular processes but also opens avenues for novel treatments in neurodegenerative diseases and cancer therapies, highlighting its significance in both basic and applied biomedical research.
