Analytical Data
-
Gene name
PNPLA8
- Application
-
Alternative Names
PNPLA8; IPLA22; IPLA2G; BM-043; Calcium-independent phospholipase A2-gamma; Intracellular membrane-associated calcium-independent phospholipase A2 gamma; iPLA2-gamma; PNPLA-gamma; Patatin-like phospholipase domain-containing protein 8; iPLA2-2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NP80
-
Expression Region
1-782 aa
-
AA Sequence
MSINLTVDIYIYLLSNARSVCGKQRSKQLYFLFSPKHYWRISHISLQRGFHTNIIRCKWTKSEAHSCSKHCYSPSNHGLHIGILKLSTSAPKGLTKVNICMSRIKSTLNSVSKAVFGNQNEMISRLAQFKPSSQILRKVSDSGWLKQKNIKQAIKSLKKYSDKSAEKSPFPEEKSHIIDKEEDIGKRSLFHYTSSITTKFGDSFYFLSNHINSYFKRKEKMSQQKENEHFRDKSELEDKKVEEGKLRSPDPGILAYKPGSESVHTVDKPTSPSAIPDVLQVSTKQSIANFLSRPTEGVQALVGGYIGGLVPKLKYDSKSQSEEQEEPAKTDQAVSKDRNAEEKKRLSLQREKIIARVSIDNRTRALVQALRRTTDPKLCITRVEELTFHLLEFPEGKGVAVKERIIPYLLRLRQIKDETLQAAVREILALIGYVDPVKGRGIRILSIDGGGTRGVVALQTLRKLVELTQKPVHQLFDYICGVSTGAILAFMLGLFHMPLDECEELYRKLGSDVFSQNVIVGTVKMSWSHAFYDSQTWENILKDRMGSALMIETARNPTCPKVAAVSTIVNRGITPKAFVFRNYGHFPGINSHYLGGCQYKMWQAIRASSAAPGYFAEYALGNDLHQDGGLLLNNPSALAMHECKCLWPDVPLECIVSLGTGRYESDVRNTVTYTSLKTKLSNVINSATDTEEVHIMLDGLLPPDTYFRFNPVMCENIPLDESRNEKLDQLQLEGLKYIERNEQKMKKVAKILSQEKTTLQKINDWIKLKTDMYEGLPFFSKL
-
Molecular Weight
114.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PNPLA8, also known as patatin-like phospholipase domain-containing protein 8, is a member of the patatin-like phospholipase family and plays a crucial role in lipid metabolism. Research has shown that PNPLA8 is involved in the regulation of lipid droplet dynamics and adipocyte function, making it significant in contexts such as obesity, diabetes, and metabolic disorders. Alterations in PNPLA8 expression have been linked to various diseases, including non-alcoholic fatty liver disease and cardiovascular diseases, emphasizing its potential as a biomarker and therapeutic target. Recent studies have focused on characterizing the enzymatic activity and substrate specificity of PNPLA8 through recombinant protein technology, enabling a deeper understanding of its role in triglyceride hydrolysis and regulation of lipid homeostasis. Such studies not only elucidate the molecular mechanisms underlying PNPLA8 function but also pave the way for the development of novel therapeutic strategies aimed at modulating lipid metabolism for the treatment of metabolic diseases. The generation of recombinant PNPLA8 allows researchers to perform functional assays and structural studies, providing insights into the protein's action at the molecular level. Consequently, understanding PNPLA8's function may offer new perspectives in managing conditions linked to dysregulated lipid metabolism.
