Analytical Data
-
Gene name
VP40
- Application
-
Alternative Names
VP40；KIAA0093；NEDD4-1；RPF1；E3 ubiquitin-Protein ligase NEDD4
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q1PD51
-
Expression Region
1-303aa
-
AA Sequence
MASSSNYNTYMQYLNPPPYADHGANQLIPADQLSNQQGITPNYVGDLNLDDQFKGNVCHAFTLEAIIDISAYNERTVKGVPAWLPLGIMSNFEYPLAHTVAALLTGSYTITQFTHNGQKFVRVNRLGTGIPAHPLRMLREGNQAFIQNMVIPRNFSTNQFTYNLTNLVLSVQKLPDDAWRPSKDKLIGNTMHPAVSVHPNLPPIVLPTVKKQAYRQHKNPNNGPLLAISGILHQLRVEKVPEKTSLFRISLPADMFSVKEGMMKKRGENSPVVYFQAPENFPLNGFNNRQVVLAYANPTLSAV
-
Molecular Weight
49.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VP40, a major matrix protein of the Ebola virus, plays a crucial role in the virus's assembly and budding processes, making it a key target for research aimed at understanding Ebola virus pathogenesis and developing antiviral strategies. Studies have shown that VP40 is not only essential for the structural integrity of the viral particle but also modulates immune responses by interfering with host cell signaling pathways. Given the high mortality rates associated with Ebola virus infections and the lack of effective therapeutics, there is an urgent need for a deeper understanding of VP40’s functional mechanisms. Recent advances in recombinant protein technologies have facilitated the production of VP40 for structural and functional analyses, allowing researchers to investigate its interactions with other viral and host proteins. Moreover, recombinant VP40 can serve as a valuable tool for vaccine development and the design of novel antiviral drugs. As such, ongoing studies continue to explore this protein's dynamics, aiming to uncover potential biochemical targets for therapeutic intervention. The synthesis and characterization of VP40 not only contribute to our understanding of Ebola virus biology but also hold significant promise in addressing the threats posed by future outbreaks.
