Analytical Data
-
Gene name
SMARCB1
- Application
-
Alternative Names
SMARCB1；BAF45D；REQ；UBID4；Zinc finger Protein ubi-d4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q12824
-
Expression Region
141-376aa
-
AA Sequence
HLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEKENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMR
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SMARCB1, also known as INI1, is a crucial tumor suppressor gene that plays a pivotal role in chromatin remodeling and transcriptional regulation. Mutations or deletions in the SMARCB1 gene have been implicated in several aggressive cancers, particularly atypical teratoid/rhabdoid tumors (AT/RT), which primarily affect children. The loss of SMARCB1 protein expression disrupts critical cellular pathways, leading to uncontrolled cell proliferation and tumorigenesis. Due to its significant role in tumorigenesis, SMARCB1 has become a focal point in cancer research, with scientists aiming to understand its functional mechanisms and explore its potential as a therapeutic target. Recent studies have involved the generation of recombinant SMARCB1 proteins to facilitate the investigation of its structural properties and interactions with other cellular components. By characterizing its biochemical functions, researchers hope to unveil novel pathways linked to SMARCB1-mediated tumor suppression and ultimately develop targeted therapies for SMARCB1-deficient cancers. Understanding the intricacies of SMARCB1 function could provide invaluable insights into tumor biology and pave the way for innovative treatment strategies, underscoring the importance of continued research in this area.
