Analytical Data
-
Gene name
BRS3
- Application
-
Alternative Names
BRS3; Bombesin receptor subtype-3; BRS-3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P32247
-
Expression Region
1-399aa
-
AA Sequence
MAQRQPHSPNQTLISITNDTESSSSVVSNDNTNKGWSGDNSPGIEALCAIYITYAVIISVGILGNAILIKVFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGRIGCKVLSFIRLTSVGVSVFTLTILSADRYKAVVKPLERQPSNAILKTCVKAGCVWIVSMIFALPEAIFSNVYTFRDPNKNMTFESCTSYPVSKKLLQEIHSLLCFLVFYIIPLSIISVYYSLIARTLYKSTLNIPTEEQSHARKQIESRKRIARTVLVLVALFALCWLPNHLLYLYHSFTSQTYVDPSAMHFIFTIFSRVLAFSNSCVNPFALYWLSKSFQKHFKAQLFCCKAERPEPPVADTSLTTLAVMGTVPGTGSIQMSEISVTSFTGCSVKQAEDRF
-
Molecular Weight
44 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BRS3, or Bombesin Receptor Subtype 3, is a member of the bombesin receptor family, which plays essential roles in various physiological processes such as metabolism, appetite regulation, and neuroendocrine function. The receptor is primarily expressed in the brain and gastrointestinal tract, where it is involved in modulating energy balance and regulating food intake. Recent studies have highlighted the potential of BRS3 as a therapeutic target for obesity and metabolic disorders, given its role in appetite suppression and energy expenditure. The development of recombinant BRS3 protein has gained significant attention, facilitating the exploration of its structure, function, and interactions with ligands. Researchers are utilizing advanced techniques, including X-ray crystallography and cryo-electron microscopy, to elucidate the receptor's three-dimensional structure and binding mechanisms. Furthermore, understanding the signaling pathways activated by BRS3 can provide insights into its involvement in various diseases, paving the way for the development of novel pharmacological agents aimed at modulating BRS3 activity. As obesity and metabolic syndrome continue to represent significant global health challenges, the investigation of BRS3 and its recombinant proteins stands at the forefront of biomedical research aimed at finding effective interventions for these conditions.
