Cat: PA1000-3893

Recombinant Human CPB1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CPB1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CPB1;Cytochrome P450 2B6

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P15086

  • Expression Region

    16-417aa

  • AA Sequence

    HHGGEHFEGEKVFRVNVEDENHINIIRELASTTQIDFWKPDSVTQIKPHS TVDFRVKAEDTVTVENVLKQNELQYKVLISNLRNVVEAQFDSRVRATGHS YEKYNKWETIEAWTQQVATENPALISRSVIGTTFEGRAIYLLKVGKAGQN KPAIFMDCGFHAREWISPAFCQWFVREAVRTYGREIQVTELLDKLDFYVL PVLNIDGYIYTWTKSRFWRKTRSTHTGSSCIGTDPNRNFDAGWCEIGASR NPCDETYCGPAAESEKETKALADFIRNKLSSIKAYLTIHSYSQMMIYPYS YAYKLGENNAELNALAKATVKELASLHGTKYTYGPGATTIYPAAGGSDDW AYDQGIRYSF TFELRDTGRYGFLLPESQIRATCEETFLAIKYVASYVLEHLYVDHHHHHH

  • Molecular Weight

    47 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CPB1, or carboxypeptidase B1, is a zinc-dependent metallopeptidase primarily involved in protein digestion and activation of proenzymes in the pancreatic context. The study of CPB1 has gained momentum due to its significant role in various physiological and pathological processes, including pancreatic disorders, obesity, and cancer. Researchers have highlighted the enzyme's potential as a biomarker for studying pancreatic function and disease progression, as altered levels of CPB1 can indicate pathological changes. Additionally, the recombinant production of CPB1 allows for the detailed investigation of its molecular structure, functional properties, and interactions with substrates and inhibitors. The recombinant protein can be utilized in both basic research and therapeutic applications, such as drug development aimed at targeting CPB1 to modulate its activity in diseases. Advances in molecular biology techniques have facilitated the efficient expression and purification of CPB1, enabling comprehensive studies on its enzymatic mechanisms and regulatory pathways. Overall, research on CPB1 not only enhances our understanding of enzymatic functions within the digestive system but also opens new avenues for clinical applications in diagnosing and treating related health conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US