Analytical Data
-
Gene name
PLGLB2
- Application
-
Alternative Names
Plasminogen-like protein B. Plasminogen-related protein B
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q02325
-
Expression Region
1-96 aa
-
AA Sequence
MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGPSLFSVTKKQLGAGSREECAAKCEEDKEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDAVLFEK
-
Molecular Weight
36.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PLGLB2, a member of the leucine-rich repeat protein family, has gained significant attention in recent years due to its potential roles in various biological processes and disease mechanisms. This protein, primarily expressed in the immune system and certain tissues, is implicated in cell signaling pathways, inflammatory responses, and possibly in the modulation of cellular growth and differentiation. Research has increasingly focused on the recombinant expression of PLGLB2 for various applications, including the study of its structure-function relationships, functional assays, and therapeutic potentials. Understanding the biochemical properties and interactions of PLGLB2 can provide insights into its role in immune responses and its potential involvement in pathological conditions such as autoimmune diseases and cancer. Advances in recombinant protein technology have enabled scientists to produce PLGLB2 in more efficient ways, facilitating in-depth studies of its function and molecular mechanisms. Therefore, the investigation of PLGLB2 as a recombinant protein is crucial for developing new therapeutic strategies and diagnostic tools targeting related diseases, making it a promising area of research in molecular biology and biotechnology.
