Cat: PA1000-3854

Recombinant Human CST2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CST2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CST2;Cleavage stimulation factor subunit 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P09228

  • Expression Region

    21-141aa

  • AA Sequence

    WSPQEEDRIIEGGIYDADLNDERVQRALHFVISEYNKATEDEYYRRLLRV LRAREQIVGGVNYFFDIEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSF QIYEVPWEDRMSLVNSRCQEA

  • Molecular Weight

    15 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CST2 (Cystatin SN) is a member of the cystatin superfamily of cysteine protease inhibitors, which play important roles in various physiological and pathological processes. Research on CST2 has gained attention due to its potential implications in neurodegenerative diseases, inflammation, and cancer. Initially identified as a neuroprotective factor, CST2 has been shown to modulate proteolytic activity in the brain, suggesting its role in maintaining protein homeostasis and protecting neurons from excessive proteolysis. The interest in CST2 has also been fueled by its differential expression patterns observed in various tissue types and disease states. For example, elevated levels of CST2 have been linked to certain tumors, indicating its potential as a biomarker for cancer progression. Furthermore, the understanding of CST2's interactions with other cellular proteins and its regulatory mechanisms can provide insights into its functional role within the cell. The ability to produce recombinant CST2 protein allows for detailed biophysical and biochemical studies, enabling researchers to explore its structure-function relationships and therapeutic applications. Overall, the investigation of CST2 recombinant protein not only enhances our understanding of its biological roles but also opens avenues for developing novel diagnostic and therapeutic strategies in various diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US