Analytical Data
-
Gene name
CST2
- Application
-
Alternative Names
CST2;Cleavage stimulation factor subunit 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P09228
-
Expression Region
21-141aa
-
AA Sequence
WSPQEEDRIIEGGIYDADLNDERVQRALHFVISEYNKATEDEYYRRLLRV LRAREQIVGGVNYFFDIEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSF QIYEVPWEDRMSLVNSRCQEA
-
Molecular Weight
15 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CST2 (Cystatin SN) is a member of the cystatin superfamily of cysteine protease inhibitors, which play important roles in various physiological and pathological processes. Research on CST2 has gained attention due to its potential implications in neurodegenerative diseases, inflammation, and cancer. Initially identified as a neuroprotective factor, CST2 has been shown to modulate proteolytic activity in the brain, suggesting its role in maintaining protein homeostasis and protecting neurons from excessive proteolysis. The interest in CST2 has also been fueled by its differential expression patterns observed in various tissue types and disease states. For example, elevated levels of CST2 have been linked to certain tumors, indicating its potential as a biomarker for cancer progression. Furthermore, the understanding of CST2's interactions with other cellular proteins and its regulatory mechanisms can provide insights into its functional role within the cell. The ability to produce recombinant CST2 protein allows for detailed biophysical and biochemical studies, enabling researchers to explore its structure-function relationships and therapeutic applications. Overall, the investigation of CST2 recombinant protein not only enhances our understanding of its biological roles but also opens avenues for developing novel diagnostic and therapeutic strategies in various diseases.











