Analytical Data
-
Gene name
TES-26
- Application
-
Alternative Names
TES-26；Testin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P54190
-
Expression Region
22-262aa
-
AA Sequence
QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA
-
Molecular Weight
27.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TES-26, a recombinant protein, has garnered significant attention in the field of molecular biology and protein research due to its potential applications in therapeutic and diagnostic settings. Originating from studies on specific disease mechanisms, TES-26 was initially identified as a candidate involved in cellular stress responses and metabolic regulation. Researchers focused on its structure and function, revealing crucial insights into its role in pathways associated with inflammation and cellular repair processes. The ability to produce TES-26 through recombinant DNA techniques allows for high-yield synthesis, facilitating detailed studies on its biochemical properties and interactions with other proteins. This advancement is vital for understanding its potential as a biomarker in various diseases, particularly those related to metabolic disorders and cancer. Moreover, recombinant TES-26 can be used in screening for novel therapeutic agents, contributing to the development of targeted therapies. As the scientific community continues to explore the functional implications of TES-26, its development represents a fascinating intersection of basic research and applied science, with the promise of improving diagnostic methods and treatment options for complex diseases.
