Cat: PA1000-3850

Recombinant Human IGFBP4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IGFBP4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IGFBP4;IBP4;Insulin-like growth factor-binding Protein 4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P22692

  • Expression Region

    22-258aa

  • AA Sequence

    DEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPCGVYT PRCGSGLRCY PPRGVEKPLHTLMHGQGVCMELAEIEAIQESLQPSDKDEGDHPNNSFSPC SAHDRRCLQK HFAKIRDRSTSGGKMKVNGAPREDARPVPQGSCQSELHRALERLAASQSR THEDLYIIPI PNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQ LADSFREVDHHHHHH

  • Molecular Weight

    27 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IGFBP4 (Insulin-like Growth Factor Binding Protein 4) is a member of the IGFBP family, which plays a crucial role in the regulation of insulin-like growth factors (IGFs). These proteins are vital for cell growth, proliferation, and differentiation, making IGFBP4 particularly significant in various physiological and pathological processes, including cancer progression, development, and metabolic disorders. Research has shown that IGFBP4 not only modulates IGF activity by prolonging its half-life and facilitating its transport to target cells but also exhibits IGF-independent functions that influence cellular signaling pathways. Additionally, alterations in IGFBP4 expression levels have been linked to various diseases, including obesity, diabetes, and certain cancers, highlighting its potential as a biomarker and therapeutic target. The production of recombinant IGFBP4 protein allows for detailed studies of its functional roles and mechanisms of action in signaling pathways. By utilizing recombinant DNA technology, researchers can generate a high-yield, purified form of IGFBP4, paving the way for in-depth investigations into its structure-function relationships and interactions with IGFs and other molecules. This research is poised to enhance our understanding of IGFBP4's contributions to health and disease, potentially leading to novel therapeutic strategies for conditions where IGFBP4 dysregulation is implicated.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US