Analytical Data
-
Gene name
BOLA2
- Application
-
Alternative Names
BOLA2; BOLA2A; My016;; BOLA2BBolA-like Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H3K6
-
Expression Region
1-124aa
-
AA Sequence
MASAKSLDRWKARLLEGGSTALTYALVRAEVSFPAEVAPVRQQGSVAGARAGVVSLLGCRSSWTAAMELSAEYLREKLQRDLEAEHVEVEDTTLNRCSCSFRVLVVSAKFEGKPLLQRHRFCTE
-
Molecular Weight
13.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BOLA2, or BolA family member 2, is a protein that has garnered interest in the field of molecular biology due to its potential roles in various cellular processes. It is part of the BolA family, which is known for its involvement in stress responses and cellular differentiation. Recent studies have suggested that BOLA2 may play a crucial role in the regulation of mitochondrial function and the cellular response to oxidative stress. Researchers have observed that BOLA2 is highly expressed in certain tissues, indicating that it may have tissue-specific functions. Additionally, abnormalities in BOLA2 expression have been linked to various diseases, including cancer and neurodegenerative disorders, prompting investigations into its potential as a therapeutic target. As the understanding of BOLA2’s structure and function grows, researchers are keen to explore its interactions with other cellular components, as well as its downstream effects on biological pathways. The development of recombinant BOLA2 protein has enabled detailed functional assays, providing further insight into its role in cellular physiology and disease. Overall, the study of BOLA2 is essential for elucidating its biological significance and potential as a biomarker or therapeutic target in human health and disease.
