Analytical Data
-
Gene name
RFC1
- Application
-
Alternative Names
RFC1；RFC140；Replication factor C subunit 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P35251
-
Expression Region
402-492aa
-
AA Sequence
GAENCLEGLIFVITGVLESIERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIRTMPGKKSKYEIA
-
Molecular Weight
11.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RFC1 (replication factor C1) is a vital component of the eukaryotic DNA replication machinery, acting as a loader for the DNA polymerase clamp, PCNA (proliferating cell nuclear antigen). The study of RFC1 is crucial due to its role in ensuring genome stability and integrity during DNA replication as it assists in the organization and coordination of various proteins involved in this complex process. Research into RFC1 has gained importance in understanding its potential implications in various diseases, particularly cancer, where DNA replication fidelity is often compromised. Abnormal RFC1 activity may contribute to genomic instability and tumor progression, making it a promising target for therapeutic intervention. Furthermore, studies have also explored the structural and functional characteristics of RFC1, revealing insights into its interactions with other replication factors, which are essential for the development of new strategies in cancer treatment. Given its pivotal role in DNA replication, an in-depth exploration of RFC1 can provide valuable information for targeted therapies and enhance our understanding of cell cycle regulation and DNA repair mechanisms.
