Analytical Data
-
Gene name
VSIG4
- Application
-
Alternative Names
VSIG4；CRIg；V-set and immunoglobulin domain-containing Protein 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y279
-
Expression Region
20-283aa
-
AA Sequence
RPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFL RDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQT PDGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARG SPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGS EQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDG YLGETSAGPGKSLPVDHHHHHH
-
Molecular Weight
30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VSIG4, also known as V-set and immunoglobulin domain containing 4, is an immunoregulatory protein primarily expressed on dendritic cells and macrophages. Its significance has emerged from its role in modulating immune responses, particularly in the context of immune tolerance and suppression. Research reveals that VSIG4 interacts with the T cell receptor, inhibiting T cell activation and promoting regulatory T cell (Treg) differentiation, making it a critical factor in maintaining immune homeostasis. This has sparked interest in exploring its potential therapeutic applications, particularly in autoimmune diseases, cancer immunotherapy, and transplant acceptance. Understanding VSIG4's mechanisms and pathways could lead to novel strategies for enhancing immune tolerance and preventing excessive immune reactions. Recent studies have focused on the structural characteristics of VSIG4, aiming to elucidate its interaction dynamics with immune cells and explore its modulatory effects in various disease models. As a result, VSIG4 stands out as a promising target for innovative immunotherapies and provides insights into the complex regulation of the immune system.
