Analytical Data
-
Gene name
PKP4
- Application
-
Alternative Names
Catenin 4; Catenin4; FLJ31261; FLJ42243; p0071; PKP 4; PKP4; PKP4_HUMAN; Plakophilin 4; Plakophilin-4; Plakophilin4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99569
-
Expression Region
12-110 aa
-
AA Sequence
EGQPQTRQEAASTGPGMEPETTATTILASVKEQELQFQRLTRELEVERQIVASQLERCRLGAESPSIASTSSTEKSFPWRSTDVPNTGVSKPRVSDAVQ
-
Molecular Weight
36.63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PKP4 (Plakophilin 4) is a member of the plakophilin family, which plays a crucial role in the formation of desmosomes—structures that ensure cell adhesion in epithelial tissues. It has garnered attention in cancer research due to its involvement in the regulation of cell signaling pathways and its potential role in tumor progression and metastasis. In recent years, studies have indicated that PKP4 may be implicated in various cancers, including breast, skin, and head and neck cancers, with altered expression levels being linked to poor prognosis. Furthermore, PKP4's interaction with other proteins in the cytoskeleton and its influence on cellular mechanics make it an important candidate for understanding the underlying mechanisms of cancer cell behavior. Recent advances in recombinant protein technology have facilitated the study of PKP4, providing insights into its structure, function, and interactions at the molecular level. By generating recombinant PKP4 protein, researchers aim to elucidate its role in desmosome assembly, cell signaling, and cancer biology. This research is critical not only for understanding the fundamental biology of epithelial cells but also for identifying potential therapeutic targets for cancer treatment. Thus, the study of PKP4 as a recombinant protein is vital for advancing our understanding of its functional roles and implications in health and disease.
