Analytical Data
-
Gene name
S100A8
- Application
-
Alternative Names
S100A8；CAGA；Protein S100-A8
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P05109
-
Expression Region
1-93aa
-
AA Sequence
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKG ADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
-
Molecular Weight
11 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
S100A8 is a member of the S100 protein family, characterized by its calcium-binding motifs and involvement in various cellular processes, including inflammation, cell proliferation, and differentiation. This protein is primarily expressed in myeloid cells, such as neutrophils and monocytes, and has been shown to play a crucial role in innate immunity. The study of human S100A8 recombinant protein has gained substantial attention due to its potential as a biomarker for various inflammatory diseases, including rheumatoid arthritis, cancer, and chronic obstructive pulmonary disease (COPD). Elevated levels of S100A8 in serum and tissues correlate with disease severity and progression, making it a promising target for therapeutic interventions. Moreover, S100A8 can form heterodimers with S100A9, resulting in the creation of the S100A8/S100A9 complex, which exhibits pro-inflammatory properties and is implicated in the pathogenesis of various disorders. Research focused on the recombinant production of S100A8 aims to better understand its functional mechanisms, develop diagnostic tools, and explore its potential as a therapeutic agent. This includes the exploration of its interactions with other proteins and signaling pathways, as well as its role in modulating the immune response. Furthermore, the advancement of biotechnological techniques facilitates the efficient production and purification of S100A8, paving the way for in-depth functional studies and potential clinical applications. Overall, the investigation of S100A8 recombinant protein holds promise for advancing our understanding of inflammatory diseases and enhancing therapeutic strategies.
