Analytical Data
-
Gene name
BCMP11
- Application
-
Alternative Names
AG-3; AG3; Agr3; AGR3_HUMAN; Anterior gradient 3; xenopus; homolog of; Anterior gradient homolog 3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TD06
-
Expression Region
1-166aa
-
AA Sequence
MMLHSALGLCLLLVTVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL
-
Molecular Weight
45.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BCMP11 is a recombinant protein derived from the family of bacterial chaperones, known for its potential applications in biotechnology and medicine. Research on BCMP11 began to address the challenges associated with protein misfolding and aggregation, which can impede the effectiveness of therapeutic proteins. This recombinant protein is believed to enhance the solubility and stability of other proteins, facilitating their proper folding during expression in host systems such as bacteria or yeast. Moreover, BCMP11 has garnered interest due to its role in cellular stress responses, making it a candidate for improving the yield and functionality of biopharmaceuticals. Studies have shown that the application of BCMP11 can lead to enhanced protein production and better post-translational modifications, essential for the activity of many therapeutic proteins. Investigating BCMP11 also opens avenues for understanding protein interactions under stress conditions, providing insights into fundamental biological processes like protein homeostasis. Ultimately, research on BCMP11 not only contributes to advancing protein engineering techniques but also holds promise for improving the manufacturing processes of biologics, addressing a growing need for efficient production systems in the pharmaceutical industry.
