Cat: PA1000-3688

Recombinant Human C1QTNF1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    C1QTNF1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    C1QTNF1;CTRP1;Complement C1q tumor necrosis factor-related Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BXJ1

  • Expression Region

    26-281aa

  • AA Sequence

    RVPHVQGEQQEWEGTEELPSPPDHAERAEEQHEKYRPSQDQGLPASRCLR CCDPGTSMYP ATAVPQINITILKGEKGDRGDRGLQGKYGKTGSAGARGHTGPKGQKGSMG APGERCKSHY AAFSVGRKKPMHSNHYYQTVIFDTEFVNLYDHFNMFTGKFYCYVPGLYFF SLNVHTWNQK ETYLHIMKNEEEVVILFAQVGDRSIMQSQSLMLELREQDQVWVRLYKGER ENAIFSEELD TYITFSGYLVKHATEP

  • Molecular Weight

    29 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

C1QTNF1, also known as C1q/TNF-related protein 1, is a member of the TNF superfamily that plays a significant role in various physiological and pathological processes, including immunoregulation, inflammation, and metabolic signaling. Its expression is observed in multiple tissues, suggesting its involvement in diverse biological functions. Recent studies have highlighted C1QTNF1's contribution to the development of insulin resistance and its potential role in obesity and type 2 diabetes, making it a target of interest for metabolic research. Additionally, C1QTNF1 has been implicated in cardiovascular diseases, indicating its relevance in cardiovascular pathophysiology. Investigating the molecular mechanisms underlying C1QTNF1 function and its interactions with other proteins may provide insights into its role in disease progression and open avenues for therapeutic interventions. The generation of recombinant C1QTNF1 protein facilitates detailed biochemical and functional assays to elucidate its biological roles, enabling a better understanding of its contributions to health and disease. This protein's study is crucial for identifying potential biomarkers and therapeutic targets in conditions related to metabolic disorders and inflammation, making it a valuable subject in contemporary biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US