Analytical Data
-
Gene name
PIWIL1
- Application
-
Alternative Names
HIWI; MIWI; Piwi (Drosophila) like 1; PIWI; Piwi homolog; Piwi like 1 (drosophila); Piwi like 1; Piwi-like protein 1; PIWIL1; PIWL1_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96J94
-
Expression Region
431-541 aa
-
AA Sequence
NDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVDDRTEAY
-
Molecular Weight
37.95 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PIWIL1, a member of the PIWI (P-element Induced Wimpy Testis) protein family, plays a crucial role in the regulation of germline development and the maintenance of stem cell functions. It is a critical component of the piRNA (PIWI-interacting RNA) pathway, which is essential for safeguarding the genome integrity by silencing transposable elements and preventing their mobilization in germ cells. The study of PIWIL1 is particularly significant in the context of reproductive biology and cancer research, as alterations in its expression and function have been implicated in various forms of cancer and infertility. Researchers have increasingly focused on the recombinant expression of PIWIL1 to explore its functional properties and mechanisms of action. By producing PIWIL1 as a recombinant protein, scientists aim to investigate its interactions with piRNAs and other cellular partners, shedding light on its role in epigenetic regulation and germline stem cell maintenance. Additionally, recombinant PIWIL1 can serve as a valuable tool in developing therapeutic interventions for diseases associated with PIWI family proteins. Understanding the structure and function of PIWIL1 contributes to a broader comprehension of the molecular basis governing gametogenesis and tumorigenesis, ultimately paving the way for innovative diagnostic and treatment strategies.
