Analytical Data
-
Gene name
BMPR2
- Application
-
Alternative Names
BMPR2；PPH1；Bone morphogenetic Protein receptor type-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13873
-
Expression Region
27-151aa
-
AA Sequence
SQNQERLCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGD INLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVN FTENFPPPDTTPLSPPHSFNRDETIVDHHHHHH
-
Molecular Weight
15 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Bone morphogenetic protein receptor type 2 (BMPR2) is a crucial component of the bone morphogenetic protein (BMP) signaling pathway, which plays a significant role in regulating cellular growth, differentiation, and apoptosis. Mutations in the BMPR2 gene are linked to various pathologies, most notably pulmonary arterial hypertension (PAH), a severe condition characterized by high blood pressure in the pulmonary arteries, leading to heart failure and reduced exercise capacity. The degradation of BMPR2 signaling is a critical factor in the development of PAH, making it a target for therapeutic interventions. The study of recombinant BMPR2 protein serves multiple purposes: it helps in understanding the molecular mechanisms underlying receptor function and its role in disease, including elucidating the pathways affected by BMPR2 mutations. Additionally, recombinant BMPR2 can be employed in drug screening to identify potential compounds that could restore or enhance its function. Moreover, it provides a valuable tool for investigating protein-protein interactions and cellular responses to BMPs in various biological contexts. Research into recombinant BMPR2 is, therefore, pivotal not only for advancing our knowledge of BMP signaling but also for developing novel treatments for BMPR2-related diseases.
