Analytical Data
-
Gene name
BCL7B
- Application
-
Alternative Names
Bcl7bB-cell CLL/lymphoma 7 Protein family member B
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BQE9
-
Expression Region
1-202aa
-
AA Sequence
MSGRSVRAETRSRAKDDIKKVMAAIEKVRKWEKKWVTVGDTSLRIFKWVPVTDSKEKEKSKSNSSAAREPNGFPSDASANSSLLLEFQDENSNQSSVSDVYQLKVDSSTNSSPSPQQSESLSPAHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES
-
Molecular Weight
48.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BCL7B, a member of the BCL7 gene family, has garnered attention in recent years due to its potential roles in oncogenesis and cellular regulation. Located on chromosome 20, BCL7B is involved in various biological processes, including cell proliferation, differentiation, and apoptosis. Research has indicated that BCL7B is frequently implicated in certain cancers, suggesting that its dysregulation may contribute to tumorigenesis. Moreover, BCL7B interacts with various protein complexes, influencing cellular signaling pathways. This interaction underlines its potential as a therapeutic target. The study of BCL7B recombinant proteins has become pivotal in elucidating its functions and mechanisms in cancer biology. By producing and characterizing BCL7B recombinants, researchers aim to better understand its structural properties, functional roles in cellular contexts, and interactions with other biomolecules. Such insights could pave the way for novel diagnostic and therapeutic strategies for cancers associated with BCL7B alterations. Consequently, the ongoing research into BCL7B recombinants not only enhances our understanding of tumor biology but also identifies potential avenues for innovative cancer treatments.
