Analytical Data
-
Gene name
KLRC1
- Application
-
Alternative Names
KLRC1;NKG2A;NKG2-A/NKG2-B type II integral membrane Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P26715
-
Expression Region
100-233aa
-
AA Sequence
HHHHHHHHRHNNSSLNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWE ESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNG LAFKHEIKDSDNAELNCAVLQVNRLKSAQC GSSIIYHCKHKL
-
Molecular Weight
16 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KLRC1, also known as NKG2A, is a key receptor expressed on natural killer (NK) cells and certain T lymphocytes, playing a crucial role in immune regulation and response to infection and cancer. The study of KLRC1 recombinant protein is significant due to its involvement in immune evasion mechanisms employed by tumors and virus-infected cells, which often exploit the expression of ligands to inhibit NK cell activity. Understanding the structural and functional properties of KLRC1 can provide insights into its interactions with these ligands, contributing to the development of therapeutic strategies aimed at enhancing anti-tumor and anti-viral immunity. Moreover, KLRC1's role in the inhibitory signaling pathways of immune cells makes it a potential target for immunotherapies. Research efforts have increasingly focused on the generation of recombinant KLRC1 proteins to investigate their binding affinity, signaling mechanisms, and potential applications in enhancing the efficacy of immunotherapeutic approaches. By elucidating the biochemical and biophysical characteristics of KLRC1, researchers hope to discover new ways to manipulate this pathway, aiming to improve host immune responses against malignancies and persistent infections. This research is pivotal in advancing our understanding of leukocyte biology and could lead to the development of innovative treatments that harness the body's immune system more effectively.











