Analytical Data
-
Gene name
PIGV
- Application
-
Alternative Names
GPI mannosyltransferase 2; GPI mannosyltransferase II; GPI MT II; GPI-MT-II; Phosphatidylinositol glycan biosynthesis class V protein; Phosphatidylinositol-glycan biosynthesis class V protein; PIG-V; Pigv; PIGV_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NUD9
-
Expression Region
1-493 aa
-
AA Sequence
MWPQDPSRKEVLRFAVSCRILTLMLQALFNAIIPDHHAEAFSPPRLAPSGFVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTELLRPLRGLLSLRSCLLISVASLNFLFFMLAAVALHDLGCLVLHCPHQSFYAALLFCLSPANVFLAAGYSEALFALLTFSAMGQLERGRVWTSVLLFAFATGVRSNGLVSVGFLMHSQCQGFFSSLTMLNPLRQLFKLMASLFLSVFTLGLPFALFQYYAYTQFCLPGSARPIPEPLVQLAVDKGYRIAEGNEPPWCFWDVPLIYSYIQDVYWNVGFLKYYELKQVPNFLLAAPVAILVAWATWTYVTTHPWLCLTLGLQRSKNNKTLEKPDLGFLSPQVFVYVVHAAVLLLFGGLCMHVQVLTRFLGSSTPIMYWFPAHLLQDQEPLLRSLKTVPWKPLAEDSPPGQKVPRNPIMGLLYHWKTCSPVTRYILGYFLTYWLLGLLLHCNFLPWT
-
Molecular Weight
82.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PIGV (phosphatidylinositol glycan anchor biosynthesis class V) is an essential gene involved in the glycosylphosphatidylinositol (GPI) anchor biosynthetic pathway, which plays a critical role in cell membrane anchoring of various proteins. Abnormalities in PIGV are linked to inherited human disorders, notably GPI-anchor deficiency syndrome, which can lead to a range of clinical manifestations including immunodeficiency, neurological issues, and developmental abnormalities. The research on recombinant PIGV protein aims to deepen our understanding of its structure-function relationships and its role in GPI-anchor biosynthesis. By producing and characterizing recombinant PIGV, researchers hope to elucidate the molecular mechanisms underlying GPI anchor formation and to explore potential therapeutic avenues for diseases related to PIGV mutations. Insights gained from this research could pave the way for novel treatments as well as improve our understanding of glycosylation processes and their implications in health and disease. As such, the study of recombinant PIGV is not only a vital endeavor in the field of glycobiology but also holds promise for translating basic research findings into clinical applications.
