Analytical Data
-
Gene name
PIGK
- Application
-
Alternative Names
PIGK; GPI8; GPI-anchor transamidase; GPI transamidase; EC 3.-.-.-; GPI8 homolog; hGPI8; Phosphatidylinositol-glycan biosynthesis class K protein; PIG-K
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92643
-
Expression Region
268-366 aa
-
AA Sequence
MNDLFQVCPKSLCVSTPGHRTDLFQRDPKNVLITDFFGSVRKVEITTETIKLQQDSEIMESSYKEDQMDEKLMEPLKYAEQLPVAQIIHQKPKLKDWHP
-
Molecular Weight
36.63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PIGK, or Phosphatidylinositol Glycan Anchor Biosynthesis Class K, is a critical enzyme involved in the biosynthesis of glycosylphosphatidylinositol (GPI) anchors, which are essential for the proper localization and function of various proteins on cell membranes. The study of PIGK and its recombinant protein has gained traction due to its significant role in cellular signaling, adhesion, and immune response. Dysregulation of GPI anchor biosynthesis, including PIGK, has been linked to various diseases, including neurological disorders and cancers. Understanding the molecular mechanisms underlying PIGK function can provide insights into these pathologies and may lead to novel therapeutic strategies. Furthermore, recombinant PIGK proteins can serve as valuable tools for studying GPI anchoring processes and for high-throughput screening of potential inhibitors or modulators of GPI biosynthesis. The exploration of PIGK not only enhances our comprehension of basic cellular functions but also opens new avenues for targeted drug development in disease contexts where GPI anchor modification plays a pivotal role.
