Cat: PA1000-3528

Recombinant Human ZNHIT1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ZNHIT1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ZNHIT1;CGBP1;Zinc finger HIT domain-containing Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O43257

  • Expression Region

    1-154aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMVEKKTSVRSQDPGQRRVLDRAARQRRINR QLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRF RKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVS CGARYCTVRCLGTHQETRCLKWTV

  • Molecular Weight

    20 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ZNHIT1, a member of the zinc finger HIT (ZNHIT) protein family, has garnered attention in recent years due to its potential roles in cellular processes and disease mechanisms. This protein is involved in various biological functions, including transcription regulation, RNA processing, and chromatin remodeling, which are crucial for maintaining cellular homeostasis and responding to environmental stimuli. Studies have indicated that ZNHIT1 may be implicated in multiple diseases, including cancer, where it could influence tumor progression and metastasis. Its expression patterns and functional implications in different tissues suggest a complex involvement in cellular signaling pathways. Furthermore, advancements in recombinant protein technology have enabled researchers to produce ZNHIT1 in vitro for detailed biochemical studies, offering insights into its structure-function relationships and potential as a therapeutic target. Understanding the roles of ZNHIT1 through the exploration of its recombinant protein could pave the way for novel diagnostic or therapeutic strategies in disease intervention and management. This underscores the importance of investigating ZNHIT1's molecular mechanisms in relation to health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US