Analytical Data
-
Gene name
ZNHIT1
- Application
-
Alternative Names
ZNHIT1；CGBP1；Zinc finger HIT domain-containing Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43257
-
Expression Region
1-154aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMVEKKTSVRSQDPGQRRVLDRAARQRRINR QLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRF RKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVS CGARYCTVRCLGTHQETRCLKWTV
-
Molecular Weight
20 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNHIT1, a member of the zinc finger HIT (ZNHIT) protein family, has garnered attention in recent years due to its potential roles in cellular processes and disease mechanisms. This protein is involved in various biological functions, including transcription regulation, RNA processing, and chromatin remodeling, which are crucial for maintaining cellular homeostasis and responding to environmental stimuli. Studies have indicated that ZNHIT1 may be implicated in multiple diseases, including cancer, where it could influence tumor progression and metastasis. Its expression patterns and functional implications in different tissues suggest a complex involvement in cellular signaling pathways. Furthermore, advancements in recombinant protein technology have enabled researchers to produce ZNHIT1 in vitro for detailed biochemical studies, offering insights into its structure-function relationships and potential as a therapeutic target. Understanding the roles of ZNHIT1 through the exploration of its recombinant protein could pave the way for novel diagnostic or therapeutic strategies in disease intervention and management. This underscores the importance of investigating ZNHIT1's molecular mechanisms in relation to health and disease.
