Analytical Data
-
Gene name
PIGC
- Application
-
Alternative Names
PIGC; GPI2; Phosphatidylinositol N-acetylglucosaminyltransferase subunit C; Phosphatidylinositol-glycan biosynthesis class C protein; PIG-C
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92535
-
Expression Region
1-297 aa
-
AA Sequence
MYAQPVTNTKEVKWQKVLYERQPFPDNYVDRRFLEELRKNIHARKYQYWAVVFESSVVIQQLCSVCVFVVIWWYMDEGLLAPHWLLGTGLASSLIGYVLFDLIDGGEGRKKSGQTRWADLKSALVFITFTYGFSPVLKTLTESVSTDTIYAMSVFMLLGHLIFFDYGANAAIVSSTLSLNMAIFASVCLASRLPRSLHAFIMVTFAIQIFALWPMLQKKLKACTPRSYVGVTLLFAFSAVGGLLSISAVGAVLFALLLMSISCLCPFYLIRLQLFKENIHGPWDEAEIKEDLSRFLS
-
Molecular Weight
60 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of PIGC recombinant proteins is grounded in the understanding of glycosylphosphatidylinositol (GPI) anchors, which are glycolipid structures that facilitate protein anchoring to cell membranes. PIGC, or Phosphatidylinositol Glycan Class C, is an essential enzyme in the GPI biosynthesis pathway, playing a crucial role in the attachment of GPI anchors to proteins. Dysfunction in PIGC has been linked to various diseases, including congenital disorders that affect the function of glycoproteins crucial for cell signaling and adhesion. The investigation of PIGC recombinant proteins aims to elucidate the detailed mechanisms of GPI biosynthesis and the implications of its dysregulation. By producing recombinant PIGC proteins, researchers can study their enzymatic activity, interaction with other components of the GPI assembly machinery, and the impact of genetic mutations on function. This research not only enhances our fundamental understanding of cellular processes but also opens avenues for therapeutic interventions in diseases linked to GPI anchor deficiencies. By employing techniques such as protein engineering and functional assays, the study of PIGC provides insights into potential strategies for correcting GPI-related malfunctions, paving the way for innovative treatments for associated disorders.
