Analytical Data
-
Gene name
ZNF32
- Application
-
Alternative Names
ZNF32；KOX30；Zinc finger Protein 32
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P17041
-
Expression Region
1-273aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMFGFPTATLLDCHGRYAQNVAFFNVMT EAHHKYDHSEATGSSSWDIQNSFRREKLEQKSPDSKTLQEDSPGVRQRVY ECQECGKSFRQKGSLTLHERIHTGQKPFECTHCGKSFRAKGNLVTHQRIH TGEKPYQCKECGKSFSQRGSLAVHERLHTGQKPYECAICQRSFRNQSNLA VHRRVHSGEKPYRCDQCGKAFSQKGSLIVHIRVHTGLKPYACTQCRKSFH TRGNCILHGKIHTGETPYLCGQCGKSFTQRGSLAVHQRSCSQRLTL
-
Molecular Weight
33 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF32, or Zinc Finger Protein 32, is a transcription factor that belongs to the family of zinc finger proteins, which are known for their role in DNA binding and gene regulation. The study of ZNF32 has gained attention due to its potential implications in various biological processes, including cell differentiation, proliferation, and apoptosis. Abnormal expression of ZNF32 has been associated with several diseases, particularly cancer, where it may influence tumor growth and metastasis. Research into the recombinant expression of ZNF32 not only aims to elucidate its functional mechanisms but also to explore its potential as a biomarker or therapeutic target. By producing recombinant ZNF32 protein in suitable expression systems, scientists can investigate its structural properties, interaction partners, and regulatory networks. These studies are crucial for understanding how ZNF32 contributes to pathological conditions and may pave the way for novel therapeutic strategies or biomarkers in disease management. The recombinant protein can also serve as a valuable tool for high-throughput screening assays to identify small molecules that can modulate its activity, further advancing the field of targeted therapy in oncology. Overall, the research on recombinant ZNF32 protein holds significant promise for uncovering the nuances of gene regulation and developing innovative approaches to combat diseases associated with its dysregulation.
