Analytical Data
-
Gene name
ZMAT3
- Application
-
Alternative Names
ZMAT3；PAG608；Zinc finger matrin-type Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HA38
-
Expression Region
1-289aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMILLQHAVLPPPKQPSPSPPMSVATRS TGTLQLPPQKPFGQEASLPLAGEEELSKGGEQDCALEELCKPLYCKLCNV TLNSAQQAQAHYQGKNHGKKLRNYYAANSCPPPARMSNVVEPAATPVVPV PPQMGSFKPGGRVILATENDYCKLCDASFSSPAVAQAHYQGKNHAKRLRL AEAQSNSFSESSELGQRRARKEGNEFKMMPNRRNMYTVQNNSAGPYFNPR SRQRIPRDLAMCVTPSGQFYCSMCNVGAGEEMEFRQHLESKQHKSKVSEQ RYRNEMENLGYV
-
Molecular Weight
34 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZMAT3 (Zinc Finger Matrin-Type 3) is a gene that encodes a protein implicated in various biological processes, including apoptosis, cell cycle regulation, and transcriptional regulation. Recent studies have highlighted its potential role in cancer biology, particularly in tumorigenesis and metastasis, due to its involvement in the modulation of gene expression. Researchers have focused on ZMAT3 as a critical player in the intricate network of signaling pathways that govern cellular responses to stress. Moreover, ZMAT3 has been associated with the regulation of several oncogenes and tumor suppressor genes, suggesting its dual role in promoting and inhibiting tumor growth under specific contexts. The recombinant form of ZMAT3 has been utilized to examine its structural and functional properties, which are essential for developing therapeutic strategies targeting its interactions in cancer cells. Investigating the molecular mechanisms through which ZMAT3 exerts its effects may uncover novel biomarkers for cancer diagnosis and prognosis, as well as potential targets for innovative treatments, thereby enhancing our understanding of its relevance in cancer biology and providing insights into its wider implications in other diseases. As the field advances, the ongoing research on ZMAT3 and its recombinant protein offers promising avenues for unraveling complex cellular dynamics and potentially developing targeted therapies.
