Analytical Data
-
Gene name
B4GALT6
- Application
-
Alternative Names
4-galactosyltransferase 6; 4-galactosyltransferase; 4-GalTase 6; AA536803; AU022389
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UBX8
-
Expression Region
1-382aa
-
AA Sequence
MSVLRRMMRVSNRSLLAFIFFFSLSSSCLYFIYVAPGIANTYLFMVQARGIMLRENVKTIGHMIRLYTNKNSTLNGTDYPEGNNSSDYLVQTTTYLPENFTYSPYLPCPEKLPYMRGFLNVNVSEVSFDEIHQLFSKDLDIEPGGHWRPKDCKPRWKVAVLIPFRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDSVWDCVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVHYAGYNVTRPEGDLGKYKSIPHHHRGEVQFLGRYKLLRYSKERQYIDGLNNLIYRPKILVDRLYTNISVNLMPELAPIEDY
-
Molecular Weight
44 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
B4GALT6, or Beta-1,4-galactosyltransferase 6, is an enzyme that plays a critical role in glycosylation, a vital post-translational modification influencing protein function, stability, and interactions. Abnormalities in glycosylation can lead to various diseases, including congenital disorders of glycosylation (CDGs). B4GALT6 is particularly significant due to its involvement in synthesizing specific glycan structures that are important for cell signaling, adhesion, and immune responses. Research has shown that mutations in the B4GALT6 gene are associated with certain CDGs, highlighting the enzyme's role in human health. Understanding the structure and function of B4GALT6 through recombinant protein studies can provide insights into its enzymatic mechanism and facilitate the development of targeted therapies for diseases linked to glycosylation defects. By producing and characterizing the recombinant B4GALT6 protein, researchers aim to elucidate its biological functions, investigate its substrate specificity, and explore potential therapeutic applications, contributing to a deeper understanding of glycosylation pathways and their implications in health and disease.
