Analytical Data
-
Gene name
C3c
- Application
-
Alternative Names
C3c；General transcription factor 3C polypeptide 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01024
-
Expression Region
672-747aa
-
AA Sequence
SVQLTEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEACK KVFLDCCNYITELRRQHARASHLGLA
-
Molecular Weight
9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C3c recombinant protein research has emerged as a significant area of interest in the field of immunology and vaccine development. The complement system, an essential component of the innate immune response, plays a crucial role in host defense against pathogens. C3, a central protein in this system, is cleaved into C3a and C3b fragments, with C3c being a byproduct of this cleavage. C3c possesses unique properties that have made it a focus for studying immune responses and potential therapeutic applications. Its ability to modulate various immune functions, including enhancing phagocytosis and influencing T-cell activation, makes C3c a candidate for vaccine adjuvants and treatments for immunological disorders. Furthermore, understanding the structural and functional characteristics of C3c can provide insights into the development of novel immune interventions. Research into C3c recombinant proteins aims to not only elucidate their mechanisms in immune modulation but also to explore their potential in boosting vaccine efficacy and developing targeted therapies for diseases where the complement system plays a pivotal role. Thus, C3c recombinant protein research represents a promising frontier in advancing our understanding of the immune system and harnessing its capabilities for therapeutic benefits.
