Cat: PA1000-3514

Recombinant Human ZADH2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ZADH2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ZADH2;ZADH2;Prostaglandin reductase 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8N4Q0

  • Expression Region

    33-377aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMQKLVVTRLSPNFREAVTLSRDCPVPL PGDGDLLVRNRFVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEVVALGL SASARYTVGQAVAYMAPGSFAEYTVVPASIATPVPSVKPEYLTLLVSGTT AYISLKELGGLSEGKKVLVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEK SAFLKSLGCDRPINYKTEPVGTVLKQEYPEGVDVVYESVGGAMFDLAVDA LATKGRLIVIGFISGYQTPTGLSPVKAGTLPAKLLKKSASVQGFFLNHYL SKYQAAMSHLLEMCVSGDLVCEVDLGDLSPEGRFTGLESIFRAVNYMYMG KNTGKIVVELPHSVNSKL

  • Molecular Weight

    39 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ZADH2, a member of the zinc finger protein family, has garnered attention in the field of molecular biology due to its potential role in various cellular processes, including gene regulation, DNA repair, and cell cycle control. Initially identified as a protein associated with zinc finger domains, ZADH2 is believed to be implicated in post-translational modifications and the response to oxidative stress, which are critical for maintaining cellular homeostasis. The understanding of ZADH2's function has significant implications, particularly in the context of cancer research and other diseases where dysregulation of these processes is observed. Recombinant protein studies of ZADH2 facilitate the exploration of its biochemical properties, interaction partners, and functional mechanisms within the cell. By producing ZADH2 in a controlled laboratory setting, researchers aim to elucidate its contributions to cellular pathways and assess its potential as a therapeutic target or biomarker. Furthermore, studies involving ZADH2 can provide insights into the intricate network of protein interactions central to cellular function, making it a valuable focus of research in understanding complex biological systems and disease mechanisms.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US