Cat: PA1000-3509

Recombinant Human YOD1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    YOD1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    YOD1;HEL-220;Transitional endoplasmic reticulum ATPase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q5VVQ6

  • Expression Region

    1-348aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMFGPAKGRHFGVHPAPGFPGGVSQQAA GTKAGPAGAWPVGSRTDTMWRLRCKAKDGTHVLQGLSSRTRVRELQGQIA AITGIAPGGQRILVGYPPECLDLSNGDTILEDLPIQSGDMLIIEEDQTRP RSSPAFTKRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPA CAPEMRRLIAQIVASDPDFYSEAILGKTNQEYCDWIKRDDTWGGAIEISI LSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFPD PDTPPLTIFSSNDDIVLVQALELADEARRRRQFTDVNRFTLRCMVCQKGL TGQAEAREHAKETGHTNFGEV

  • Molecular Weight

    41 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

YOD1, also known as Yod1 or YOD1-like protein, is a member of the deubiquitinating enzyme (DUB) family, which plays a crucial role in regulating protein stability and cellular processes by removing ubiquitin moieties from target proteins. Research into YOD1 has gained prominence due to its implications in various cellular functions and potential connections to diseases, including cancer and neurodegenerative disorders. It has been observed that YOD1 is involved in the endoplasmic reticulum-associated degradation (ERAD) pathway, where it aids in the removal of misfolded proteins from the endoplasmic reticulum, thus maintaining cellular homeostasis. Additionally, studies suggest that YOD1 could influence various signaling pathways by modulating the ubiquitination status of key regulatory proteins. The understanding of YOD1’s structure and function is increasingly vital, not only for elucidating its role in fundamental biological processes but also for the development of novel therapeutic strategies targeting dysfunctional DUBs in disease conditions. As the research community delves deeper into the molecular mechanisms by which YOD1 operates, it is hoped that breakthroughs may be achieved that leverage this knowledge toward innovative treatments and biomarker discovery.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US