Analytical Data
-
Gene name
SIAT1
- Application
-
Alternative Names
SIAT1；SIAT1；Beta-galactoside alpha-2.6-sialyltransferase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P15907
-
Expression Region
1-406aa
-
AA Sequence
MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC
-
Molecular Weight
52.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SIAT1, or sialyltransferase 1, is a key enzyme involved in the biosynthesis of sialic acids on glycoproteins and glycolipids, which play crucial roles in cellular interactions, immune response, and pathogen recognition. Research into SIAT1 has gained momentum due to its significant implications in various biological processes and diseases. Elevated levels of SIAT1 have been associated with cancer progression, metastasis, and the evasion of immune surveillance, indicating its potential as a therapeutic target and prognostic biomarker. Moreover, the role of sialylation in neurobiology has prompted investigations into SIAT1's involvement in neurodevelopmental disorders and neurodegenerative diseases. Recent advances in recombinant protein technique have enabled the production and study of SIAT1 in vitro, facilitating a deeper understanding of its enzymatic mechanisms, substrate specificity, and regulatory factors. This research not only enhances our knowledge of sialylation pathways but also opens avenues for novel therapeutic strategies aimed at modulating SIAT1 activity in various clinical contexts. Thus, the investigation of SIAT1 recombinant protein is pivotal for elucidating its functional roles and therapeutic potential in health and disease.
