Cat: PA2000-5724

Recombinant Human AVEN Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AVEN

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MGC124011; OTTMUSP00000016129; PDCD12; Programmed cell death 12; RP23-52C15.2

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NQS1

  • Expression Region

    1-362aa

  • AA Sequence

    MQAERGARGGRGRRPGRGRPGGDRHSERPGAAAAVARGGGGGGGGDGGGRRGRGRGRGFRGARGGRGGGGAPRGSRREPGGWGAGASAPVEDDSDAETYGEENDEQGNYSKRKIVSNWDRYQDIEKEVNNESGESQRGTDFSVLLSSAGDSFSQFRFAEEKEWDSEASCPKQNSAFYVDSELLVRALQELPLCLRLNVAAELVQGTVPLEVPQVKPKRTDDGKGLGMQLKGPLGPGGRGPIFELKSVAAGCPVLLGKDNPSPGPSRDSQKPTSPLQSAGDHLEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSKNVTEEELEDWLDSMIS

  • Molecular Weight

    64.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

AVEN (Apoptosis and Caspase Activation Inhibitor) is a protein that has garnered significant interest in the field of cancer research due to its role in regulating apoptosis and maintaining cell survival. Originally identified as a caspase inhibitor, AVEN is involved in cellular responses to stress and plays a critical role in the development and progression of various cancers. Studies have shown that AVEN can modulate apoptotic pathways, allowing cancer cells to evade programmed cell death, which contributes to tumor growth and resistance to therapy. Recent research has focused on the structural and functional characterization of AVEN, aiming to understand its molecular mechanisms and how it interacts with other proteins in apoptotic signaling pathways. This has led to explorations of AVEN as a potential therapeutic target; inhibiting its function might restore apoptotic processes in cancer cells, enhancing the efficacy of existing treatments. Furthermore, understanding AVEN's role could provide insights into resistance mechanisms in cancer therapies, paving the way for novel strategies in cancer treatment. Researchers are employing techniques such as recombinant protein expression and structural biology to elucidate AVEN's conformation and binding properties, which is critical for the development of small molecules or peptides that can disrupt its function. This emerging body of work highlights AVEN not only as a vital player in apoptosis regulation but also as a promising candidate for targeted cancer therapies, signifying a shift towards more personalized treatment options in oncology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US