Cat: PA2000-5725

Recombinant Human AVP Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AVP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AVP; Beta type antiviral Protein; CRF2-1; Cytokine receptor class-II member 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P01185

  • Expression Region

    20-124aa

  • AA Sequence

    CYFQNCPRGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAAFGVCCNDESCVTEPECREGFHRRA

  • Molecular Weight

    37.18 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

AVP (Arginine Vasopressin) is a peptide hormone primarily involved in regulating water balance and blood pressure in the human body. It plays a significant role in the body's response to osmotic stress and has been implicated in various physiological and pathological processes, including cardiovascular health, fluid retention, and stress response. Recent studies have highlighted the importance of AVP not only in endocrine functions but also in its potential influence on neurobehavioral disorders, thereby generating interest in its therapeutic applications. The recombination and expression of AVP as a recombinant protein have become critical areas of research, as this enables detailed studies of its structure-function relationships and the development of AVP-based therapeutics. By utilizing modern biotechnological approaches, researchers aim to produce AVP effectively in microbial or cell-based systems, which can facilitate large-scale production for both research and clinical use. This work lays the foundation for novel insights into AVP's role in human health and disease, and paves the way for potential interventions in conditions such as diabetes insipidus, heart failure, and anxiety disorders. Understanding the molecular mechanisms and interactions of AVP at a protein level could lead to innovative treatment strategies and enhance our comprehension of hormonal regulation and its impacts on various bodily systems.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US