Cat: PA1000-3491

Recombinant Human WRS Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    WRS

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    WRS;IFI53;Tryptophan--tRNA ligase. cytoplasmic

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P23381

  • Expression Region

    1-471aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMPNSEPASLLELFNSIATQGELVRSLKAGN ASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEA EEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHH FLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFT KWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDIN KTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISF PAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYP KPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGG RDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGEL KKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ

  • Molecular Weight

    55 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

WRS (Wheat Germ Reconstituted Protein) is a plant-based protein derived from wheat germ, which has attracted significant interest in the field of biotechnology and nutrition due to its potential applications in food science and health supplementation. The increasing global demand for sustainable protein sources, coupled with growing concerns over the environmental impact of animal farming, has propelled research into alternative proteins derived from plants. WRS is particularly noteworthy as it offers a balanced amino acid profile, essential for human nutrition, while also being rich in vitamins and minerals. Researchers have dedicated efforts to optimize the extraction and purification processes of WRS, aiming to enhance its functionality and bioavailability. Additionally, studies are being conducted to explore its potential health benefits, including its role in improving muscle protein synthesis and supporting overall metabolic health. The versatility of WRS allows it to be incorporated into various food products, meeting the needs of vegetarians and those seeking healthier dietary options. Thus, the ongoing research into WRS not only addresses nutritional needs but also aligns with the global shift towards more sustainable food systems, promising to contribute significantly to the future landscape of dietary proteins.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US