Analytical Data
-
Gene name
WFDC12
- Application
-
Alternative Names
WFDC12；C20orf122；WAP four-disulfide core domain Protein 12
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WWY7
-
Expression Region
24-111aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSVKEGIEKAGVCPADNVRCFKSDPPQCH TDQDCLGERKCCYLHCGFKCVIPVKELEEGGNKDEDVSRPYPEPGWEAKC PGSSSTRCPQK
-
Molecular Weight
12 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
WFDC12, a member of the WAP (whey acidic protein) four-disulfide core domain family, has garnered interest in recent years for its potential roles in various biological processes. This protein is predominantly expressed in the human uterus and has been implicated in reproductive health, particularly in the regulation of endometrial function and embryo implantation. Its structure features a unique combination of conserved cysteine residues that form disulfide bonds, contributing to its stability and functional diversity. Research has suggested that WFDC12 may play a role in modulating immune responses during early pregnancy, as well as in the maintenance of pregnancy by influencing uterine receptivity. Additionally, alterations in WFDC12 expression have been associated with various pathological conditions, including infertility and certain cancers. This has spurred investigations into the therapeutic potential of WFDC12 as a biomarker for reproductive health and its role in disease mechanisms. The recombinant expression of WFDC12 allows for detailed studies of its biological functions, interactions with other proteins, and potential applications in clinical settings. Thus, understanding WFDC12 at a molecular level could provide insights into reproductive physiology and contribute to the development of novel diagnostic and therapeutic strategies.
