Analytical Data
-
Gene name
MAGEF1
- Application
-
Alternative Names
MAGEF1；Melanoma-associated antigen F1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HAY2
-
Expression Region
1-307aa
-
AA Sequence
MLQTPESRGLPVPQAEGEKDGGHDGETRAPTASQERPKEELGAGREEGAAEPALTRKGARALAAKALARRRAYRRLNRTVAELVQFLLVKDKKKSPITRSEMVKYVIGDLKILFPDIIARAAEHLRYVFGFELKQFDRKHHTYILINKLKPLEEEEEEDLGGDGPRLGLLMMILGLIYMRGNSAREAQVWEMLRRLGVQPSKYHFLFGYPKRLIMEDFVQQRYLSYRRVPHTNPPEYEFSWGPRSNLEISKMEVLGFVAKLHKKEPQHWPVQYREALADEADRARAKARAEASMRARASARAGIHLW
-
Molecular Weight
35.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MAGEF1 (Melanoma Antigen Family E Member 1) is a member of the MAGE (Melanoma Antigen Gene) family, known for its role in immune response and potential implications in cancer immunotherapy. This gene is predominantly expressed in testicular germ cells and various malignant tissues, making it a target of interest in cancer research. MAGEF1 is involved in regulating key cellular processes, including apoptosis and cell proliferation, which are critical in tumorigenesis. Research indicates that MAGEF1 may contribute to tumor evasion mechanisms, allowing cancer cells to escape immune detection. Given its restricted expression in normal tissues and enhanced expression in cancer, MAGEF1 presents a promising candidate for developing cancer vaccines and targeted therapies. Recent studies have focused on the production and characterization of recombinant MAGEF1 proteins to elucidate their structure-function relationships, interactions with immune cells, and potential as neoantigens. Understanding the precise role of MAGEF1 in tumor biology and its interactions with the immune system is crucial for harnessing its potential in novel therapeutic approaches. Overall, the ongoing research into MAGEF1 recombinant proteins aims to advance personalized immunotherapies, improve cancer treatment outcomes, and expand the therapeutic repertoire against various malignancies.
