Cat: PAX2000-10268

Recombinant Human PGRMC2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PGRMC2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Progesterone membrane-binding protein;Steroid receptor protein DG6

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O15173

  • Expression Region

    67-223 aa

  • AA Sequence

    GAYRLWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRILLAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHNKQD

  • Molecular Weight

    24.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PGRMC2 (Progesterone Receptor Membrane Component 2) is a protein that has garnered significant attention in recent years due to its multifaceted roles in cellular processes. Initially identified as a component associated with the progesterone receptor, PGRMC2 is involved in various biological functions, including cell proliferation, apoptosis, and stress response. Research indicates that it plays a crucial role in modulating steroid hormone signaling and is implicated in the development of certain cancers, particularly breast cancer, where it influences tumor growth and response to therapy. The protein's ability to interact with various signaling pathways makes it an important factor in cellular homeostasis and a potential therapeutic target. Moreover, its unique structure and membrane association raise interesting questions about its functional mechanisms and interactions with other cellular components. As the understanding of PGRMC2's functions expands, there is a growing interest in developing recombinant forms of the protein to facilitate studies on its interactions, modifications, and biological activities. By producing recombinant PGRMC2, researchers aim to elucidate its role in health and disease, potentially leading to novel interventions in hormone-related disorders and cancers. Thus, studying PGRMC2 not only enhances our understanding of steroid hormone biology but also opens new avenues for biomedical research and therapeutic development.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US